PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_22073_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 285aa    MW: 32888.9 Da    PI: 10.1482
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_22073_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-142367348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT++Ed++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
   Neem_22073_f_1 23 TWTQQEDDILREQISIHGTENWSIIASKFK-DKTTRQCRRRWYTYL 67
                     6****************************9.*************97 PP

2Myb_DNA-binding44.73.2e-1473116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
   Neem_22073_f_1  73 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 116
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0671667IPR017930Myb domain
SuperFamilySSF466893.18E-2620114IPR009057Homeodomain-like
SMARTSM007173.5E-132069IPR001005SANT/Myb domain
CDDcd001678.16E-122367No hitNo description
Gene3DG3DSA:1.10.10.605.4E-212474IPR009057Homeodomain-like
PfamPF139211.4E-152484No hitNo description
PROSITE profilePS5129420.05568122IPR017930Myb domain
SMARTSM007171.1E-1472120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-2075121IPR009057Homeodomain-like
CDDcd001678.54E-1076117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MQESKNKISA NEESKKKERH IVTWTQQEDD ILREQISIHG TENWSIIASK FKDKTTRQCR  60
RRWYTYLNSD FKKGGWSPEE DMLLCEAQKI FGNRWTEIAK VVSGRTDNAV KNRFSTLCKK  120
RAKYEALAKE NNNAYINPNN KRILFQDGFS TDGTLENTAP AKRARRAHIP ELTENCSFGN  180
RSHRQSGTPI NQNLRSPFSV LPQNFPSVTN LPAKHHDVKE DLNDAAQNNK TQGTFLKKDD  240
PKITALMQQA ELLSSLAQKV NTENTEQSLE HAWKVQTIHQ RIIRH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-282412210108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483205.11e-173PREDICTED: myb-related protein A isoform X3
TrEMBLV4VH491e-171V4VH49_9R
TrEMBLV4SVH31e-171V4SVH3_9R
STRINGVIT_01s0026g01910.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.11e-121myb domain protein 88